PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG189800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 457aa    MW: 48055.8 Da    PI: 6.8531
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG189800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.2e-19109155148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg+WT+eEde l+  v+++G + W++I+r+++ gR +kqc++rw ++l
  Pavir.9NG189800.1.p 109 RGPWTEEEDETLKAMVEMYGDRKWAAISRHLP-GRIGKQCRERWTNHL 155
                          89******************************.************996 PP

2Myb_DNA-binding51.52.4e-16165205345
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           WT+e+d  l++a+k +G++ W++Iar++  gR+++++k++w+
  Pavir.9NG189800.1.p 165 IWTEEDDMNLIEAHKVYGNR-WSLIARKLE-GRSENSVKNHWN 205
                          6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.649104159IPR017930Myb domain
SuperFamilySSF466893.74E-30108204IPR009057Homeodomain-like
SMARTSM007177.7E-19108157IPR001005SANT/Myb domain
PfamPF002497.9E-18109155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-22109157IPR009057Homeodomain-like
CDDcd001676.13E-17111155No hitNo description
PROSITE profilePS5129418.535160212IPR017930Myb domain
SMARTSM007172.2E-15162210IPR001005SANT/Myb domain
PfamPF002495.0E-14166205IPR001005SANT/Myb domain
CDDcd001671.75E-13166208No hitNo description
Gene3DG3DSA:1.10.10.608.7E-16166206IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MDGGSSARFG HGVAAGPVHL GGGAQLVVPA AAGMFPAGVG SFLLGAGGML PPVGGNMVQH  60
GGYLAPGGYG TVPSALHATW NGVAAAAGGG QQHPPAGAGI GVRRLAAFRG PWTEEEDETL  120
KAMVEMYGDR KWAAISRHLP GRIGKQCRER WTNHLRPEID KAKNIWTEED DMNLIEAHKV  180
YGNRWSLIAR KLEGRSENSV KNHWNATKRS LKAKRRLKKK KNAEAPPGQQ WSILEEYIRS  240
LRPDELAAAP PAPSDDSPPS SYNNVGYGGE VVSPPAAPAP AGGGFDPAAM RLYLSAAAAG  300
SSSSAVNNLA AMNRNPNMAA QPYLGLDLNA YYYGAPLQQQ TPPPTPMMMT MMGQDQHQAA  360
ASYSADNLMM TYPFVDHLQA WHSPAPNADA YAATNANAGP HYSYYSDAGA GPSAAAAAAP  420
APANPQDDVD VVQMASREFQ LNPSDEEVTL NLAGFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-391092077103B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464189.11e-103hypothetical protein SORBIDRAFT_01g013830
TrEMBLK4ALU71e-122K4ALU7_SETIT; Uncharacterized protein
STRINGSi039882m1e-122(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.25e-37Homeodomain-like protein